Skip to product information
1 of 3

RSPO3 Protein, Human

RSPO3 Protein, Human

Catalog Number: UA040025 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $172 USD
Regular price Sale price $172 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms R-spondin 3
Accession Q9BXY4-1
Amino Acid Sequence

Gln22-Val146, with C-terminal 8*His QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

16 and 20-24kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

R-spondin3 (RSPO3), an activator of Wnt/β-catenin signaling, plays a key role in tumorigenesis of various cancers. RSPO3 contains two adjacent cysteine-rich furin-like domains (aa 35-135) with one potential N-glycosylation site (aa 36), followed by a thrombospondin (TSP-1) motif (aa 147-207) and a region rich in basic residues (aa 211-269). RSPO3 is a novel contraction-inducible myokine produced by cultured human myotubes. Human RSPO3 is a paracrine factor that may positively participate in the myogenesis processes of myoblasts and satellite cells. RSPO3 promotes the tumor growth of choriocarcinoma via Akt/PI3K/ERK signaling, which supports RSPO3 as an oncogenic driver promoting the progression of choriocarcinoma. RSPO3 plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this protein with bone mineral density and risk of fracture. 

Picture

Bioactivity

Measured by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells.
The EC50 for this effect is less than 20ng/mL in the presence of 5ng/mL Recombinant Human Wnt‑3a. 

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized RSPO3 His Tag, Human (Cat. No. UA040025) at 2.0μg/mL (100μL/well) can bind ZNRF3 Fc Chimera Protein, Human (Cat. No. UA011119) with EC50 of 1.59-3.16 ng/mL.