Skip to product information
1 of 1

Rat Alpha-1-acid Glycoprotein Protein, His tag

Rat Alpha-1-acid Glycoprotein Protein, His tag

Catalog Number: S0A0176 Reactivity: Rat Conjugation: Unconjugated Brand: Starter
Price:
Regular price $599.00 SGD
Regular price Sale price $599.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Rat
Synonyms Orosomucoid (OMD), Orm1
Accession P02764
Amino Acid Sequence

Protein sequence (P02764, Gln19-Pro205, with C-His tag) QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP

Expression System HEK293
Molecular Weight Predicted MW: 23.3 kDa Observed MW: 23-43 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Alpha-1-acid glycoprotein, also known as orosomucoid, is a major acute-phase protein synthesized primarily in the liver. As a glycoprotein with high carbohydrate content, it exhibits increased plasma levels during inflammation, infection, or tissue injury, reflecting its role in immune modulation and host defense. Structurally, AGP binds to various ligands, including drugs, lipids, and cytokines, influencing drug pharmacokinetics and immune cell interactions. It is involved in regulating inflammation, modulating lymphocyte function, and potentially contributing to tumor progression.

Picture

SDS-PAGE

4μg(R: reducing conditions)