Skip to product information
1 of 3

PD-L1/B7-H1 His Tag Protein, Cynomolgus

PD-L1/B7-H1 His Tag Protein, Cynomolgus

Catalog Number: UA010386 Reactivity: Cynomolgus Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $520 USD
Regular price Sale price $520 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Cynomolgus
Antigen PD-L1
Synonyms PD-L1, B7-H1, CD274, PDCD1L1, PDCD1LG1
Accession G7PSE7
Amino Acid Sequence

Phe19-Arg238, with C-terminal 8*His FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNERGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 32-40kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Salih H R. et al. (2006) The role of leukemia-derived B7-H1 (PD-L1) in tumor-T-cell interactions in humans. Exp Hematol. 34(7): 888-894.

2、Wilcox R A. et al. (2009) B7-H1 (PD-L1, CD274) suppresses host immunity in T-cell lymphoproliferative disorders. Blood. 114(10): 2149-2158.

3、Ruggiero A. et al. (2009) Crystal structure of PD-L1, a ribosome inactivating protein from Phytolacca dioica L. leaves with the property to induce DNA cleavage. Biopolymers. 91(12): 1135-1142.

Background

Programmed death ligand 1 (PD-L1) belongs to the B7 series and is a 33-kDa type 1 transmembrane glycoprotein that contains 290 amino acids with Ig-V and IgC domains in its extracellular region. PD-L1 expression can be detected on hematopoietic cells including T cells, B cells, macrophages, dendritic cells (DCs), and mast cells, and non-hematopoietic healthy tissue cells including vascular endothelial cells, keratinocytes, pancreatic islet cells, astrocytes, placenta syncytiotrophoblast cells, and corneal epithelial and endothelial cells. PD-L1 is an essential immune checkpoint protein that binds to programmed death 1 (PD-1) on T-lymphocytes. Engagement of PD-1 by PD-L1 alters the activity of T cells in many ways, inhibiting T cell proliferation, survival, cytokine production, and other effector functions. T cell plays a critical role in killing cancer cells while the cancer cell exhibits immune escape by the expression of PD-L1. The binding of PD-L1 to PD-1 inhibits T cell proliferation and activity, leading to tumor immunosuppression.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

ELISA

Immobilized PD-L1/B7-H1 His Tag, Cynomolgus (Cat. No. UA010386) at 2.0μg/mL (100μL/well) can bind PD-1 Fc Chimera, Cynomolgus (Cat. No. UA010304) with EC50 of 0.47-0.76μg/ml.

SPR

Protein A Chip captured PD-1 Fc Chimera, Cynomolgus (Cat. No. UA010304), can bind PD-L1/B7-H1 His Tag, Cynomolgus (Cat. No. UA010386) with an affinity constant of 33.98μM as determined in SPR assay.