Skip to product information
1 of 1

LYPD3 His Tag Protein, Human

LYPD3 His Tag Protein, Human

Catalog Number: UA010207 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $605.00 SGD
Regular price Sale price $605.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms LYPD3, MIG-C4, C4.4A
Accession O95274
Amino Acid Sequence

Leu31-Cys326, with C-terminal 8* His

LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGCGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 48-80kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Fletcher G C. et al. (2003) hAG-2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan. Br. J. Cancer. 88: 579-585.

2、Hu T. et al. (2022) LYPD3, a New Biomarker and Therapeutic Target for Acute Myelogenous Leukemia. Front Genet. 13: 795820.

Background

LYPD3 (Ly6/PLAUR domain-containing protein 3, C4.4A), first reported in 1998, is a tumorigenic and high-glycosylated cell surface protein that has been proven to be linked with the carcinogenic effects in different solid tumors. The extracellular region of LYPD3 includes two such LU domains (D1 and D2) followed by a C-terminal region, which is rich in serine, threonine and proline. Circumstantial evidence suggests that LYPD3 plays a role in adhesion, migration and invasion similar to that of uPAR. Aberrant expression of LYPD3 plays an oncogenic role in several types of cancer. Expression of the human LYPD3 was observed by RT-PCR and Northern blotting in placental tissue, skin, esophagus and peripheral blood leukocytes, but not in brain, lung, liver, kidney, stomach, colon and lymphoid organs. As demonstrated for malignant melanoma, LYPD3 mRNA expression correlated with tumor progression. The elevated expression of LYPD3 is not only demonstrated to be associated with lung adenocarcinoma carcinogenesis and poor prognosis but also there is evidence that LYPD3 can lead to the initiation and development of cancers and the chemoresistance of metastatic cancers by impacting the and apoptosis of the tumor, which are involved in many important regulatory mechanisms of cancers. This suggests LYPD3 as a potential diagnostic marker.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).