Skip to product information
1 of 3

IL-6R alpha/CD126 Fc Chimera Protein, Human

IL-6R alpha/CD126 Fc Chimera Protein, Human

Catalog Number: UA010448 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $775.00 SGD
Regular price Sale price $775.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen IL-6R alpha/CD126
Synonyms IL-6 receptor subunit alpha, IL-6R subunit alpha, IL-6R-alpha, IL-6RA
Accession P08887
Amino Acid Sequence

Leu20 - Pro365, with C-terminal Human IgG1 Fc

LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

76-93 kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.M Hibi, M Murakami, M Saito, T Hirano, T Taga, TKishimoto. Molecular cloning and expression of an IL-6 signal transducer,gp130.Cell. 1990 Dec 21;63(6):1149-57.
2. Bin S, Xin L, Lin Z, Jinhua Z, Rui G, Xiang Z.Targeting miR-10a-5p/IL-6Raxis for reducing IL-6-induced cartilage cell ferroptosis.Exp Mol Pathol. 2021Feb;118:104570. Cell., 63 (1990), pp. 1149-1157.

Background

The Interleukin-6 receptor (IL-6R) consists of an 80-kDa IL-6 binding protein (α chain) (CD126) and gp130. The alpha-chain CD126 is a glycoprotein that contains the ligand-binding site. The human IL-6R protein contains 468 amino acids, which includes a signal peptide, an extracellular region, a transmembrane domain, and a short cytoplasmic domain of 19, 339, 28, and 82 amino acids, respectively. IL-6R are present on several types of tumor cells, including multiple myeloma, hepatocellular carcinoma, prostate carcinoma , and epidermoid carcinoma. The IL-6/IL-6R signal pathway promotes the tumor growth in various cancers, especially for glioma. Hence, IL-6R not only can be used as a target site for transporting drugs, but also as a therapeutic site. Primary human cartilage cells express IL-6R, which is further induced in the presence of IL-6. This makes cartilage cells direct targets or effectors of IL-6.

Picture

Bioactivity

 Protein A Chip captured IL-6R alpha/CD126 Fc Chimera, Human (Cat. No. UA010448), can bind IL-6, Human (Cat. No. UA040052) with an affinity constant of 8.51 nM as determined in SPR assay.

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized IL-6, Human (Cat. No. UA040052) at 5.0μg/mL (100μL/well) can bind IL-6R alpha/CD126 Fc Chimera, Human (Cat. No. UA010448) with EC50 of 3.04-3.92ng/ml.