Skip to product information
1 of 3

IL-18BP His Tag Protein, Human

IL-18BP His Tag Protein, Human

Catalog Number: UA010574 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $409.00 SGD
Regular price Sale price $409.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen IL-18BP
Synonyms IL18BP, IL18BPa, Tadekinig-alfa
Accession O95998-2
Amino Acid Sequence

Thr31-Gly194, with C-terminal 8*His TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

40-50kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Review Front ImmunoQl . 2013 Oct 8;4:289.

Background

Interleukin-18 binding protein, also known as IL-18BP and tadekinig-alfa, is a secreted glycoprotein that contains an Ig-like C2-type domain. IL-18BP is a cytokine receptor that belongs to the interleukin 1 receptor family. IL18BP shares many characteristics with soluble cytokine receptors of the IL1 family in that the protein exhibits specificity for IL18, belongs to the immunoglobulin-like class of receptors and has limited amino acid sequences with those of the IL1 receptor type II. According to the other study, IL1R9 is evolutionarily related to IL18BP and may function as an IL-18 receptor. Plasma il-18 /IL18BP levels increase during disease activity, suggesting that it may play a role in the pathogenesis of ITP.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized IL-18, Human (Cat. No. UA040111) at 2.0μg/mL (100μL/well) can bind IL-18BP His Tag, Human (Cat. No. UA010574) with EC50 of 0.68-0.91ng/ml.


SPR

Anti-His antibody Immobilized on CM5 Chip captured IL-18BP His Tag, Human (Cat. No. UA010574), can bind IL-18, Human Cat. No. UA040111) with an affinity constant of 3.15nM as determined in SPR assay.