Skip to product information
1 of 1

Human Trypsin 2 Protein, His tag

Human Trypsin 2 Protein, His tag

Catalog Number: S0A0149 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $219.00 SGD
Regular price Sale price $219.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Trypsin-2, Anionic trypsinogen, Serine protease 2, Trypsin II, PRSS2, TRY2, TRYP2
Accession P07478
Amino Acid Sequence

Protein sequence (P07478, Ala16-Ser247, with C-His tag) APFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS

Expression System Pichia pastoris
Molecular Weight

Predicted MW: 26.6 kDa Observed MW: 25 kDa

Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Protease, serine, 2 (trypsin 2) is a protein that in humans is encoded by the PRSS2 gene. This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7.

Picture

SDS-PAGE

2μg(R: reducing conditions; NR: non-reducing conditions)