Skip to product information
1 of 1

Human TNF-β Protein, His Tag

Human TNF-β Protein, His Tag

Catalog Number: S0A0212 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Lymphotoxin-alpha, LT-alpha, TNF-beta, Tumor necrosis factor ligand superfamily member 1, LTA, TNFB, TNFSF1
Accession P01374
Amino Acid Sequence

Protein sequence (P01374, Leu35-Leu205, with C-His Tag) LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Expression System HEK293
Molecular Weight Predicted MW: 20.3 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNF-beta, also known as Lymphotoxin-alpha (LTα), is a cytokine belonging to the tumor necrosis factor (TNF) superfamily. Its primary function involves the development and organization of secondary lymphoid organs, such as lymph nodes and spleen, during embryogenesis. In adulthood, TNF-beta is a key mediator in the maintenance of the lymphoid architecture and the initiation of inflammatory responses against pathogens. It exists in two forms: a soluble homotrimer that signals through TNF receptors 1 and 2, and a membrane-bound heterotrimer with LTβ, which signals through the LTβ receptor. Dysregulation of TNF-beta is implicated in autoimmune and chronic inflammatory diseases, making it a significant therapeutic target.

Picture

Bioactivity

Immobilized Human TNF-β Protein, His tag at 5 μg/mL (100 μL/well) can bind TNFR-1/CD120a Protein, Human (Cat. No. UA040030) with EC50 of 3.2-4.5 ng/ ml.

SDS-PAGE

2μg(R: reducing conditions)