Skip to product information
1 of 1

Human NUT, His tag

Human NUT, His tag

Catalog Number: S0A6039 Brand: Starter
Price:
Regular price $110 USD
Regular price Sale price $110 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Nuclear protein in testis, C15orf55, NUT
Accession Q86Y26
Amino Acid Sequence

Protein sequence (Q86Y26, Thr920-Ala997, with C-10*His) TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 10.1 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The nuclear protein in testis gene encodes a 1,132-amino acid protein termed NUT that is expressed almost exclusively in the testes, ovaries, and ciliary ganglion. NUT protein facilitates the acetylation of chromatin by histone acetyltransferase EP300 in testicular spermatids. BRD4 is the bromodomain-containing protein 4 gene. BRD4 protein involved in the development of neoplasms. The product of the BRD4-NUTM1 fusion gene, BRD4-NUT protein, stimulates the expression of at least 4 oncogenes, MYC, TP63, SOX2, and MYB in cultured cells. It is generally accepted that the BRD4-NUT protein promotes these neoplasms by maintaining their neoplastic cells in a perpetually undifferentiated, proliferative state. NUT carcinoma is a rare, highly aggressive malignancy. Studies have found that 66%-80% of NUT carcinomas harbor a BRD4-NUTM1 fusion gene while the remaining NUT carcinomas involve the BRD3-NUTM1, NSD3-NUTM1, ZNF532-NUTM1, or ZNF592-NUTM1 fusion gene.

Picture

SDS-PAGE

2 μg(R: reducing conditions)