Skip to product information
1 of 1

Human LIF, His tag

Human LIF, His tag

Catalog Number: S0A4033 Brand: Starter
Price:
Regular price $194.00 SGD
Regular price Sale price $194.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Differentiation-stimulating factor (D factor), Melanoma-derived LPL inhibitor (MLPLI), HILDA
Accession P15018
Amino Acid Sequence

Protein sequence (P15018, Met1-Phe202, with C-10*His) MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 23.7 kDa Observed MW: 33-43 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Leukemia inhibitory factor, or LIF, is an interleukin 6 class cytokine that affects cell growth by inhibiting differentiation. When LIF levels drop, the cells differentiate. LIF derives its name from its ability to induce the terminal differentiation of myeloid leukemic cells, thus preventing their continued growth. Other properties attributed to the cytokine include: the growth promotion and cell differentiation of different types of target cells, influence on bone metabolism, cachexia, neural development, embryogenesis and inflammation. It has been suggested that recombinant human LIF might help to improve the implantation rate in women with unexplained infertility. LIF is often added to stem cell culture media as an alternative to feeder cell culture, due to the limitation that feeder cells present by only producing LIF on their cell surfaces. LIF promotes self-renewal by recruiting signal transducer and activator of transcription 3 (Stat3).

Picture

SDS-PAGE

2μg(R: reducing conditions)