Skip to product information
1 of 2

GFP His Tag protein, Aequorea victoria

GFP His Tag protein, Aequorea victoria

Catalog Number: UA070020 Reactivity: Other Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $340.00 SGD
Regular price Sale price $340.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Aequorea victoria
Antigen GFP
Synonyms GFP Protein
Accession AAB65663
Amino Acid Sequence

Ser2-Lys238, with N-terminal 8*His HHHHHHHHSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Expression System E.coli
Molecular Weight 27.8kDa
Purity >95% by SDS-PAGE&RP-HPLC
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1.Trends Biochem Sci 1995 Nov;20(11):448-55.
2.Biol Chem. 1998 Dec 25;273(52):34970-5.

Background

The green fluorescent protein (GFP) is a protein that exhibit bright green fluorescence when exposed to blue light. It is a widely used reporter in gene expression and protein localization studies. the green fluorescent protein (GFP) from the jellyfish Aequorea victoria is a widely used reporter in studies of gene expression and protein localization. GFP is a single chain polypeptide of 238 amino acids .Most of these amino acids form β sheets that are compacted through an antiparallel structure to form the barrel. So far, they have been used as reporters of gene expression, tracers of cell lineage, and as fusion tags to monitor protein localization within living cells.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

RP-HPLC