Skip to product information
1 of 1

Ephrin B3 Fc Chimera Protein, Human

Ephrin B3 Fc Chimera Protein, Human

Catalog Number: UA010150 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $649.00 SGD
Regular price Sale price $649.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession Q15768
Amino Acid Sequence

Leu28-Ser224, with C-terminal Human IgG Fc

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 60-65kDa (Reducing)
Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

 Ephrin-B3 binds HSPGs on HEK-293T, HeLa, and CHO cells, where heparin blocks binding to HEK-293T cells independently of Eph receptors, and a heparin/HS-binding domain in ephrin-B3 was identified outside of the Eph-receptors binding domain. The two positively charged residues, Arg178 and Lys179, in the ephrin-B3's juxtamembrane region is important for heparin/HS binding. Changing the corresponding amino acids in the non-heparin binding ephrin-B1 to positively charged residues gave heparin binding. Ephrin-A3 also binds HS, where Lys176 corresponds to Lys179 in ephrin-B3. Ephrin-B3 binding to lymphocytes and lymphoma cell lines may also depend on other residues near the transmembrane domain, in particular Arg188 which is less affected by heparin, suggesting several mechanisms for ephrin-B3 binding to cells. Functional studies revealed that ephrin-B3 binding to cells induces signaling, influencing both cell rounding and spreading.

Picture

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

RP-HPLC

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)