Skip to product information
1 of 3

DNAM-1/CD226 His Tag Protein, Human

DNAM-1/CD226 His Tag Protein, Human

Catalog Number: UA010072 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $592.00 SGD
Regular price Sale price $592.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession Q15762
Amino Acid Sequence Glu19-Asn247, with C-terminal 8*His EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 44-57 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

DNAX accessory molecule 1 (DNAM-1; CD226) is a costimulatory molecule belonging to the immunoglobulin superfamily. DNAM-1 is primarily expressed on NK and CD8 T cells, which has been shown to enhance the cytotoxic effector function of NK cells and T cells against tumor- and virus-infected cells. DNAM-1 is a member of the Ig superfamily, encoded by a gene on human chromosome 18q22.3, is expressed by human NK cells, T cells, a subset of B cells, monocytes and platelets. Interactions between DNAM-1 on NK cells and its ligands on tumour cells augments the NK cell–mediated cytotoxicity and cytokine production. CD155 and its related family member CD112, the known ligands for DNAM-1, broadly expressed on hematopoietic, epithelial, and endothelial cells. Moreover, it was shown that the interaction of DNAM-1 with CD112 and CD155 contributes to the NK-mediated lysis of both imDCs and mDCs. NK cells also express CD96, which shows only ~20% homology to DNAM-1 but was also shown to recongnize CD155 and promote NK cell adhesion and activation. Decreased NK cell activity has been observed in patients with PDAC, and pancreatic cancer patients have less CD226+ NK cells in the blood than do healthy controls. Dysregulation of DNAM-1 is associated with susceptibility to juvenile idiopathic arthritis, type 1 diabetes (T1D), lupus, and rheumatoid arthritis in patients.

Picture

Bioactivity

Anti-His antibody Immobilized on CM5 Chip captured DNAM-1/CD226 His Tag, Human (Cat. No. UA010072), can bind CD155/PVR Fc Chimera, Human (Cat. No. UA010118) with an affinity constant of 0.419μM as determined in SPR assay.
Immobilized DNAM-1/CD226 His Tag, Human (Cat. No. UA010072) at 2μg/mL (100μL/well) can bind CD155/PVR Fc Chimera, Human (Cat. No. UA010118) with EC50 of 0.317μg/ml.

SDS-PAGE

1μg(R: reducing conditions, N: non-reducing conditions).