Skip to product information
1 of 3

CEACAM-5/CD66e His Tag Protein, Human

CEACAM-5/CD66e His Tag Protein, Human

Catalog Number: UA010288 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $520 USD
Regular price Sale price $520 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CEACAM-5, CD66e, CEA, Meconium antigen 100
Accession P06731
Amino Acid Sequence

Lys35-Ala685, with C-terminal 10*His KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

95-150kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Hammarstrom S. (1999). The carcinoembryonic antigen (CEA) family: structures, suggested functions and expression in normal and malignant tissues. Seminars in Cancer Biology. 9(2): 67-81.

Background

The human CEA family has been fully characterized. It comprises 29 genes of which 18 are expressed; 7 belonging to the CEA subgroup and 11 to the pregnancy specific glycoprotein subgroup. CEA is an important tumor marker for colorectal and some other carcinomas. The CEA subgroup members are cell membrane associated and show a complex expression pattern in normal and cancerous tissues with notably CEA showing a selective epithelial expression. Several CEA subgroup members possess cell adhesion properties and the primordial member, biliary glycoprotein, seems to function in signal transduction or regulation of signal transduction possibly in association with other CEA sub-family members.

Picture

FC

2e5 of transient transfected anti-CEACAM-5 ScFv CAR-293 cells were stained with 0.1ug CEACAM-5/CD66e His Tag Protein, Human, (Cat. No. UA010288) and His tag Recombinant Rabbit mAb and unrelated protein (Fig. C and B and D), and non-transfected 293 cells were used as a control (Fig. A). Alexa Fluor® 647 signal was used to evaluate the binding activity. 2e5 of transient transfected anti-CEACAM-5 ScFv CAR-293 cells were stained with isotype and Whitlow/218 Linker-Alexa Fluor® 488 (Fig. F and E). Alexa Fluor® 488 signal was used to evaluate the binding activity.

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized CEACAM-5/CD66e His Tag, Human (Cat. No. UA010288) at 2.0μg/mL (100μL/well) can bind Anti-Human CEA Monoclonal Antibody (Labetuzumab) with EC50 of 1.81-2.15ng/mL.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)