Skip to product information
1 of 1

CEACAM-1/CD66a His Tag Protein, Cynomolgus

CEACAM-1/CD66a His Tag Protein, Cynomolgus

Catalog Number: UA010325 Reactivity: Cynomolgus Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $540 USD
Regular price Sale price $540 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Cynomolgus
Synonyms CEACAM1, CD66a, BGP, BGP1, BGPI
Accession XP_005589426.2
Amino Acid Sequence Gln35-Gly428, with C-terminal 8*His QLTIESRPFNVAEGKEVLLLAHNLSQNLIGYNWHKGERVDAKRLIVAYVIETKQTTPGPAHSGREMIYSNASLLIQNVTQNDTGSYTLQVIKGDLVNEEATGQFRVYPELPKPNITINNSNPVEDKDVVTFTCESEAQDTTYLWWVNNQSLPVSSRLQLSNGNKTLTLLSVLRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCSAASNPPAQYSWLINETFQQSTQELFIPNITVNNSGSYTCHANNSVTGRNRTTVKMIIVSEQSLVVAQPQIKASKTTVTEDKDYVNLTCSTNDTGISISWFFKDQSLPSSERMKLSQDNATLSINPVKREDAGNYSCEVFNLISKNRSDPIVLIVNYNNPAQENSLPAGGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 65-93kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Tsugawa N. et al. (2021) CEACAM1 specifically suppresses B cell receptor signaling-mediated activation. Biochem Biophys Res Commun. 535: 99-105.

Background

Carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) is a type I transmembrane glycoprotein and a member of the CEA family. The extracellular domain of CEACAM1 consists of a membrane-distal immunoglobulin (Ig)V-like N-region and variable numbers of alternating IgC1- and IgC2-like proximal regions. Therefore, this molecule is also classified as a member of the Ig supergene family. Several heterophilic ligands for the N-domain of CEACAM1 have been reported. However, homophilic ligation of the N-domains of CEACAM1 with another N-domain of CEACAM1 is the predominant means of physiologic interaction. CEACAM1 has been reported to be involved in several functions such as tumor growth, angiogenesis, endocrine function and immunology in humans and rodents.

Picture

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).