Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | CD74, DHLAG, HLADG, Ia-GAMMA, p33, CLIP, INVG34 |
| Accession | P04233-2 |
| Amino Acid Sequence | Gln73-Met232, with N-terminal 8*His HHHHHHHHGGGSQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM |
| Expression System | HEK293 |
| Molecular Weight | 28-33kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Zola H. et al. (2007) CD molecules 2006-human cell differentiation molecules. J Immunol Methods. 318(1-2): 1-5. 2、Ho I C. et al. (2009) GATA3 and the T-cell lineage: essential functions before and after T-helper-2-cell differentiation. Nat Rev Immunol. 9(2): 125-135. 3、Matesanz-Isabel J. et al. (2011) New B-cell CD molecules. Immunology Letters. 134(2): 104-112. |
Background
CD74 (MHC class II invariant chain, Ii) is a non-polymorphic type II transmembrane glycoprotein. It was initially identified to act mainly as an MHC class II chaperone. However, it is clear that CD74 has a much wide range of biological functions in physiological and pathological situations in addition to its regulatory roles on cell surface MHC II expression. CD74 also participates in other non-MHC II protein trafficking. Importantly, CD74 molecule is a cell membrane high-affinity receptor for macrophage migration inhibitory factor (MIF), D-dopachrome tautomerase (D-DT/MIF-2), and bacterial proteins that also behave as an accessory signaling molecule, which undergoes regulated intramembrane proteolysis (RIP) upon its ligand binding.
Picture
Picture
SDS-PAGE

