Skip to product information
1 of 3

CD48 His Tag Protein, Human

CD48 His Tag Protein, Human

Catalog Number: UA010595 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $653.00 SGD
Regular price Sale price $653.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen CD48
Synonyms BCM1, SLAMF2, BLAST, BLAST1, MEM-102, TCT.1, BCM-1, SLAMF-2
Accession P09326-1
Amino Acid Sequence

Gln27-Ser220, with C-terminal 8*His Tag QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 35-45kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Shannon L McArdel. Roles of CD48 in regulating immunity and tolerance. Clin Immunol. 2016 Mar; 164:10-20.Epub 2016 Jan 18.

Background

CD48, a member of the signaling lymphocyte activation molecule family, participates in adhesion and activation of immune cells. Although constitutively expressed on most hematopoietic cells, CD48 is upregulated on subsets of activated cells. CD48 can have activating roles on T cells, antigen presenting cells and granulocytes, by binding to CD2 or bacterial FimH, and through cell intrinsic effects. Interactions between CD48 and its high affinity ligand CD244 are more complex, with both stimulatory and inhibitory outcomes. CD244:CD48 interactions regulate target cell lysis by NK cells and CTLs, which are important for viral clearance and regulation of effector/memory T cell generation and survival.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

ELISA

Immobilized CD48 His Tag, Human (Cat. No. UA010595) at 2.0μg/mL (100μL/well) can bind 2B4/CD244 Fc Chimera, Human(Cat. No. UA010890) with EC50 of 36.94-47.14 ng/mL.

SPR

Protein A Chip captured 2B4/CD244 Fc Chimera, Human (Cat. No. UA010890), can bind CD48 His Tag, Human(Cat. No. UA010595) with an affinity constant of 17.70nM as determined in SPR assay.