Skip to product information
1 of 1

CD3 epsilon Fc Chimera Protein, Cynomolgus

CD3 epsilon Fc Chimera Protein, Cynomolgus

Catalog Number: UA010173 Reactivity: Cynomolgus Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $540 USD
Regular price Sale price $540 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Cynomolgus
Synonyms CD3,T3e,CD3epsilon
Accession Q95LI5
Amino Acid Sequence

Gln22-Asp117, with C-terminal Human IgG1 Fc

QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 37-43kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

CD3 has five kinds of peptide chains, namely γ chain, δ chain, ε chain, ζ chain and η chain, all of which are transmembrane proteins. The transmembrane region of CD3 molecule connects to the transmembrane region of two peptide chains of TCR through salt bridge, forming the TCR-CD3 complex, which is involved in nervous system development and positive regulation of cell adhesion. CD3 acts upstream of or within several processes, including positive regulation of T cell activation; positive regulation of cytokine production; and regulation of signal transduction.CD3 is located in several cellular components, including dendritic spine; external side of plasma membrane; and immunological synapse. Part of alpha-beta T cell receptor complex. CD3 is expressed in colon and hemolymphoid system.

Bispecific therapies targeting CD3, so-called T-cell engagers (TCE), belong to the new spectrum of anti-tumor immunotherapies stimulating T-lymphocytes. TCE are unique constructs targeting the MHC-independent CD3 epsilon subunit (CD3e) and a tumor antigen. Some TCE are in advances development, with promising results targeting CD20 and BSMA in lymphoma and myeloma. These successes have relaunched the development of TCE in solid tumors, bringing mixed results so far (notably in terms of tolerance). Still, TCE pave the way to new immunotherapy in tumors considered to be refractory to inhibitors of immune checkpoints such as prostate cancer or colorectal cancer.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).