Skip to product information
1 of 1

Brain Natriuretic Peptide Protein, Human

Brain Natriuretic Peptide Protein, Human

Catalog Number: UA030022 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $390.00 SGD
Regular price Sale price $390.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Brain natriuretic peptide 32, Gamma-brain natriuretic peptide, B-type Natriuretic Peptide, GC-B, BNP-32
Accession P16860
Amino Acid Sequence

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Expression System E.coli
Molecular Weight

3.5 kDa (Reducing)

Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris-HCl, 200mM NaCl, pH8.5
Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriuretic peptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from the ventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF) and atrial septal defect in patients without HF.

Picture

SDS-PAGE

Brain Natriuretic Peptide, Human, 1μg on SDS-PAGE under Non-reducing and reducing condition. The purity is greater than 95%.

RP-HPLC

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)