Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Brain natriuretic peptide 32, Gamma-brain natriuretic peptide, B-type Natriuretic Peptide, GC-B, BNP-32 |
| Accession | P16860 |
| Amino Acid Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Expression System | E.coli |
| Molecular Weight | 3.5 kDa (Reducing) |
| Purity | >95%, by SDS-PAGE under reducing conditions |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris-HCl, 200mM NaCl, pH8.5 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriuretic peptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from the ventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF) and atrial septal defect in patients without HF.
Picture
Picture
SDS-PAGE

RP-HPLC


