Skip to product information
1 of 2

Biotinylated PD-1 Avi&His Tag Protein, Human

Biotinylated PD-1 Avi&His Tag Protein, Human

Catalog Number: UA010427 Reactivity: Human Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $640.00 SGD
Regular price Sale price $640.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms PD-1, CD279, SLEB2, PDCD1
Accession Q15116
Amino Acid Sequence

Leu25-Gln167, with C-terminal Avi & 8*His Tag LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQGGGSGLNDIFEAQKIEWHEHHHHHHHH

Expression System HEK293
Molecular Weight

30-43kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Ishida Y. et al. (1992) Induced expression of PD-1, a novel member of the immunoglobulin gene superfamily, upon programmed cell death. EMBO J. 11: 3887.

Background

Programmed death 1 receptor (PD-1), also known as CD279, is a type I transmembrane protein belonging to the immune regulatory receptor CD28 family. PD-1 is expressed on the surface of activated T cells, B cells, macrophages, myelocytes, and a subset of thymocytes. Mature human PD-1 consists of a 148 amino acid (aa) extracellular region (ECD) with one immunoglobulin-like V-type domain, a 24 aa transmembrane domain, and a 95 aa cytoplasmic region. The tail of the cytoplasmic region contains two tyrosine residues, forming the immune receptor tyrosine inhibitory motif (ITIM) and immune receptor tyrosine switching motif (ITSM), which are important for mediating PD-1 signaling. PD-1 has two ligands, PD-L1 and PD-L2, which are members of the B7 family. PD-L1 is expressed in almost all mouse tumor cell lines, whereas the expression of PD-L2 is more restricted and mainly expressed by DC and a few tumor lines.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized Biotinylated PD-1 Avi&His Tag Protein, Human (Cat. No. UA010427) at 2 μg/mL on Streptavidin precoated (0.5μg/well) plate, can bind PD-L2/B7-DC Fc Chimera Protein, Cynomolgus (Cat. No. UA010299) with EC50 of 1.64-2.18ng/ml.