Skip to product information
1 of 1

Biotinylated LILRA3 His&Avi Tag Protein, Human

Biotinylated LILRA3 His&Avi Tag Protein, Human

Catalog Number: UA010327 Reactivity: Human Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $731.00 SGD
Regular price Sale price $731.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms LILRA3, ILT6, LIR4, CD85e
Accession Q8N6C8
Amino Acid Sequence Gly24-Glu439, with C-terminal 8*His&Avi tag GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEGGGSHHHHHHHHGLNDIFEAQKIEWHE
Expression System HEK293
Molecular Weight 68-75kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Knight J S. et al. (2017) Activated signature of antiphospholipid syndrome neutrophils reveals potential therapeutic target. JCI Insight. 2(18): e93897.

Background

Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3) is also known as CD85 antigen-like family member E (CD85e), immunoglobulin-like transcript 6 (ILT-6) belongs to a family of leucocyte receptors. LILRA3 lacks a transmembrane domain and it is highly homologous to other LILR genes, and can bind human leukocyte antigen (HLA) class I. The biologic role of the LILRA3 molecule and the nature of its ligand are not known. LILRA3 can bind with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes. It can be detected in B-cells, natural killer (NK) cells, peripheral blood monocytes and lung. LILRA3 transcripts are markedly upregulated in neutrophils from patients with antiphospholipid syndrome (APS). Some polymorphisms of the LILR genes are reported to be associated with susceptibility to diseases such as rheumatoid arthritis and multiple sclerosis.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).