Skip to product information
1 of 2

Biotinylated FOLR1 His&Avi Tag Protein, Mouse

Biotinylated FOLR1 His&Avi Tag Protein, Mouse

Catalog Number: UA010437 Reactivity: Mouse Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $640.00 SGD
Regular price Sale price $640.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms FOLR1, FBP, FOLR, FRα, Folate receptor 1, Folate-binding protein 1
Accession P35846
Amino Acid Sequence

Thr25-Ser232, with C-terminal 8*His & Avi Tag TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGGGSHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight 33-43kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Senol S. et al. (2015) Folate receptor α expression and significance in endometrioid endometrium carcinoma and endometrial hyperplasia. International Journal of Clinical and Experimental Pathology. 8(5): 5633-5641.

Background

Folate Receptor 1 (FOLR1), also known as Folate Receptor alpha and Folate Binding Protein (FBP), is a 37-42 kDa protein that mediates the cellular uptake of folic acid and reduced folates. FOLR1 is predominantly expressed on epithelial cells and is dramatically upregulated on many carcinomas. Mature FOLR1 is an N-glycosylated protein that is anchored to the cell surface by a GPI linkage. FOLR1 is internalized to the endosomal system where it dissociates from its ligand before recycling to the cell surface. The soluble form of FOLR1 can be shed from the cell surface and into serum and breast milk through protein hydrolysis.

Picture

Bioactivity

Immobilized Folic Acid-BSA at 2.0μg/mL (100μL/well) can bind Biotinylated FOLR1 His&Avi Tag, Mouse (Cat. No. UA010437) with EC50 of 0.17-0.19μg/mL .

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).