Skip to product information
1 of 1

LTBR/TNFRSF3 Fc Chimera Protein, Human

LTBR/TNFRSF3 Fc Chimera Protein, Human

Catalog Number: UA010554 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $613.00 SGD
Regular price Sale price $613.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen LTBR/TNFRSF3
Synonyms Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein
Accession P36941
Amino Acid Sequence

Gln31-Met227, with C-terminal Human IgG Fc QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 55-65kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Piao W., Xiong Y., Li L., et al. Regulatory T cells condition lymphatic endothelia for enhanced transendothelial migration. Cell Reports. 2020;30(4):1052-1062.e5.
2. Schneider K, Potter KG, and Ware CF (2004). Lymphotoxin and LIGHT signaling pathways and target genes. Immunol. Rev. 202, 49-66.
3. Norris P.S., Ware C.F. Madame Curie Bioscience Database. Landes Bioscience; Austin, TX, USA: 2000-2013.
4. Force W.R., Walter B.N., Hession C., Tizard R., Kozak C.A., Browning J.L., Ware C.F. Mouse lymphotoxin-beta receptor. Molecular genetics, ligand binding, and expression. J. Immunol. 1995; 155:5280-5288.
5. Boehm T., Scheu S., Pfeffer K., Bleul C.C. Thymic medullary epithelial cell differentiation, thymocyte emigration, and the control of autoimmunity require lympho-epithelial cross talk via LTbetaR. J. Exp. Med. 2003; 198:757-769.

Background

LTBR is a type 1 single transmembrane protein and member of the tumor necrosis factor receptor (TNFR) family that plays a critical role in the development of secondary lymphoid organs. The human LTBR gene is located on chromosome 12p13, in the same locus as two other members of the TNFR family—TNFR1 and CD27. The human LTBR gene shares 76% homology at the nucleic acid level with its mouse counterpart, located on chromosome 6. LTBR is widely expressed in blood and LECs, intestinal epithelial cells, dendritic cells (DCs), and lymph node (LN) stromal cells. The protein is conspicuously absent in T cells, B cells, and NK cells. LTBR binds strongly to two different natural ligands in homeostatic conditions, LTα1β2 and LIGHT (TNFSF14). LTBR signaling pathway plays an essential role in lymphatic organogenesis, tissue regeneration, organ development, tumorigenesis, and immune response to pathogen infection. Functionally, the absence of LTBR signaling leads to the retention of mature T cells in the thymic medulla.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)