2μg (R: reducing conditions, N: non-reducing conditions).
IRF3 His Tag Protein, Human
IRF3 His Tag Protein, Human
Price:
Regular price
$582.00 SGD
Regular price
Sale price
$582.00 SGD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | IIAE7, Interferon regulatory factor 3 IRF 3 |
| Accession | Q14653 |
| Amino Acid Sequence | Gly2-Ser427, with N-terminal 8*His HHHHHHHHHHDYKDDDDKKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCP HHHHHHHHGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES |
| Expression System | E.coli |
| Molecular Weight | 48.2kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 500mM NaCl, 1mM EDTA, 2mM DTT, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.J Cell Sci. 2019 Jul 24;133(5): jcs230409. |
Background
Regulatory factor (IRF) family - IRF-3 is the key transcriptional regulator of type I interferon (IFN)-dependent immune responses which plays a critical role in the innate immune response against DNA and RNA viruses. IRF3 regulates the transcription of type I IFN genes (IFN-alpha and IFN-beta) and IFN-stimulated genes (ISG) by binding to an interferon-stimulated response element (ISRE) in their promoters. It acts as a more potent activator of the IFN-beta (IFNB) gene than the IFN-alpha (IFNA) gene and plays a critical role in both the early and late phases of the IFNA/B gene induction. IRF3found in an inactive form in the cytoplasm of uninfected cells and following viral infection, double-stranded RNA (dsRNA), or toll-like receptor (TLR) signaling, is phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization and nuclear localization and association with CREB binding protein (CREBBP) to form dsRNA-activated factor 1 (DRAF1), a complex which activates the transcription of the type I IFN and ISG genes. It can activate distinct gene expression programs in macrophages and can induce significant apoptosis in primary macrophages.
Picture
Picture
SDS-PAGE
RP-HPLC
ELISA
Immobilized IRF3 His Tag, Human (Cat. No. UA010640) at 2.0μg/mL (100μL/well) can bind IRF3 Recombinant Rabbit mAb (S-449-24) (Cat. No. S0B0598) with EC50 of 0.59-0.92ng/mL.
