TSH alpha beta Heterodimer
Human TSH alpha/beta Heterodimer, His tag
Human TSH alpha/beta Heterodimer, His tag
Price:
Regular price
$260.00 SGD
Regular price
Sale price
$260.00 SGD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Thyroid-stimulating hormone subunit beta (TSH-B; TSH-beta), Thyrotropin beta chain, Anterior pituitary glycoprotein hormones common subunit alpha, Choriogonadotropin alpha chain, Chorionic gonadotrophin subunit alpha (CG-alpha), Follicle-stimulating hormone alpha chain (FSH-alpha), Follitropin alpha chain |
| Accession | P01215、P01222 |
| Amino Acid Sequence | Protein sequence(P01222&P01215,Phe21-Tyr132&Ala25-Ser116, with C-10*His) FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY & APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:24.7 kDa Actual:35-70 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/mg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Thyroid stimulating hormone, beta also known as TSHB is a protein which in humans is encoded by the TSHB gene. Thyrotropin-stimulating hormone (TSH) is a noncovalently linked glycoprotein heterodimer and is part of a family of pituitary hormones containing a common alpha subunit (TSHA) and a unique beta subunit (this protein) that confers specificity. Glycoprotein hormones, alpha polypeptide is a protein that in humans is encoded by the CGA gene. The gonadotropin hormones, human chorionic gonadotropin (hCG), luteinizing hormone (LH), follicle-stimulating hormone (FSH), and thyroid-stimulating hormone (TSH) are heterodimers consisting of alpha and beta subunits (also called chains) that are associated non-covalently. The alpha subunits of these four human glycoprotein hormones are identical; however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family.
Picture
Picture
SDS-PAGE
