Skip to product information
1 of 1

Human RAGE Protein, His tag

Human RAGE Protein, His tag

Catalog Number: S0A0134 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $241.00 SGD
Regular price Sale price $241.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Advanced glycosylation end product-specific receptor, Receptor for advanced glycosylation end products, AGER
Accession Q15109
Amino Acid Sequence

Protein sequence (Q15109, Ala23-Glu322, with C-His tag) AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIE

Expression System HEK293
Molecular Weight Predicted MW: 34 kDa Observed MW: 50 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

RAGE (receptor for advanced glycation end products), also called AGER, is a 35 kilodalton transmembrane receptor of the immunoglobulin super family. Its name comes from its ability to bind advanced glycation end products (AGE), which include chiefly glycoproteins, the glycans of which have been modified non-enzymatically through the Maillard reaction. In view of its inflammatory function in innate immunity and its ability to detect a class of ligands through a common structural motif, RAGE is often referred to as a pattern recognition receptor. RAGE also has at least one other agonistic ligand: high mobility group protein B1 (HMGB1). The interaction between RAGE and its ligands is thought to result in pro-inflammatory gene activation. Due to an enhanced level of RAGE ligands in diabetes or other chronic disorders, this receptor is hypothesized to have a causative effect in a range of inflammatory diseases such as diabetic complications, Alzheimer's disease and even some tumors.

Picture

Bioactivity

Immobilized Human HMGB1 at 4 μg/mL (50 μL/well) can bind Human RAGE Protein, His tag with EC50 of 0.21-0.25 μg/mL.

SDS-PAGE

2μg(R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)