Human HE4, His Tag
Human HE4, His Tag
Price:
Regular price
$300 USD
Regular price
Sale price
$300 USD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Accession | Q14508 |
| Amino Acid Sequence | EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFGGGGSHHHHHHHHHH. |
| Expression System | HEK293 |
| Molecular Weight | 11.7 kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 0.2M PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Background
HE4 (human epididymis protein 4) is a new tumor marker for ovarian cancer, and the incidence of ovarian cancer ranks third among the three gynecological malignancies. Early diagnosis is crucial to the cure rate of ovarian cancer. Normally, HE4 is expressed at very low levels in humans, but it can be very high in the tissues and serum of ovarian cancer patients and has a high sensitivity for ovarian cancer detection, especially in the early asymptomatic stage.This product is the recombinant human HE4 protein expressed from human 293 cells (HEK293).
Picture
Picture
SDS-PAGE
