Skip to product information
1 of 2

Human CEA, His Tag

Human CEA, His Tag

Catalog Number: S0A6001 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P06731
Amino Acid Sequence

Protein sequence (P06731,CEAM-5, Lys35-Ser680, with C-10*His)


KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight 72.5 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

Background

CEA (carcinoembryonic antigen) is an acidic glycoprotein with the characteristics of human embryo antigen. It exists on the surface of cancer cells derived from endodermal cells and is a structural protein of cell membrane. This protein is formed in the cytoplasm and secreted into the surrounding body fluids. Therefore, it can be detected in various body fluids and excreta such as serum, cerebrospinal fluid, breast milk, gastric juice, pleural and abdominal fluid, urine and feces. As a specific marker for the early diagnosis of colon and rectal cancer, CEA level is found to increase not only in gastrointestinal malignancies, but also in serum of breast cancer, lung cancer and other malignancies through a large number of clinical practices.Therefore, CEA is a broad-spectrum tumor marker. Although it cannot be used as a specific index for the diagnosis of certain malignant tumors, it still has important clinical value in the differential diagnosis, disease monitoring and efficacy evaluation of malignant tumors.This product is the recombinant human CEA protein expressed from human 293 cells (HEK293).

Picture

Bioactivity

Immobilized Human CEA, His Tag at 1 μg/mL (50 μL/well) can bind CEA(CD66e) Recombinant Rabbit mAb (SDT-098-54) (S0B2091) with EC50 of 3.455-4.312 ng/mL.

SDS-PAGE

1μg(R: Reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)