Skip to product information
1 of 1

Human CD3 delta, His tag

Human CD3 delta, His tag

Catalog Number: S0A1042 Brand: Starter
Price:
Regular price $45 USD
Regular price Sale price $45 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms T-cell surface glycoprotein CD3 delta chain, T-cell receptor T3 delta chain, CD3d
Accession P04234
Amino Acid Sequence

Protein sequence(P04234, Phe22-Ala105, with C-10*His) FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:11.2kDa Actual:18-25kDa
Purity >90% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD3 delta is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene.

Picture

Bioactivity

2μg(R: reducing conditions)