Skip to product information
1 of 1

GPA33 His Tag Protein, Mouse

GPA33 His Tag Protein, Mouse

Catalog Number: UA010510 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $532.00 SGD
Regular price Sale price $532.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Antigen GPA33
Synonyms Cell surface A33 antigen, Glycoprotein A33, GPA33, Glycoprotein A33 (Transmembrane), Transmembrane Glycoprotein A33, A33
Accession Q9JKA5
Amino Acid Sequence

Leu22-Ile235, with C-terminal 8*His LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVTWNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSLMSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSPQYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIESCNITVAPRPPSMNIGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 33-40kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Heath, J. K. , White, S. J. , Johnstone, C. N. , Catimel, B. , Simpson, R. J. , Moritz, R. L. , Tu, G. F. , et al. The human A33 antigen is a transmembrane glycoprotein and a novel member of the immunoglobulin superfamily. Proc. Natl. Acad. Sci. U. S. A. 1997. 94: 469-474.

Background

Glycoprotein A33 (GPA33) is also known as Cell surface A33 antigen, is a single-pass type I membrane protein which is expressed in normal gastrointestinal epithelium and in 95% of colon cancers.GPA33 has high homology with CD2 and contains a V‐type Ig‐like domain at the N terminus. It is also related to proteins that have inhibitory roles in T cell activation, such as CD276 (B7‐H3) and VSIG4 and several cell adhesion molecules, such as CEACAM, ICAM, and NCAM (3D‐Protein BLAST, NCBI). Although its molecular function is not known, GPA33 has been associated with immune dysregulation. GPA33 may play a role in cell-cell recognition and signaling.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)