Skip to product information
1 of 1

EPCR/PROCR His Tag Protein, Mouse

EPCR/PROCR His Tag Protein, Mouse

Catalog Number: UA010516 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $1,285.00 SGD
Regular price Sale price $1,285.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Antigen EPCR/PROCR
Synonyms Endothelial cell protein C receptor, Activated protein C receptor, APC receptor, EPCR, PROCR, CD201
Accession Q64695
Amino Acid Sequence

Leu18-Ser214, with C-terminal 8*His LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTSGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 33-43kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Montes, R. et al. (2012) Thromb. Haemost. 107:815. 2. Bae, J.-S. et al. (2007) Blood 110:3909. 3. Fink, K. et al. (2013) PLoS One 8:e53103. 4. Willcox, C.R. et al. (2012) Nat. Immunol. 13:872. 5. Turner, L. et al. (2013) Nature 498:502.

Background

The endothelial protein C receptor (EPCR), also known as CD201, is an approximately 50 kDa transmembrane glycoprotein expressed on vascular endothelial cells and functions as a negative regulator of thrombosis. EPCR inhibits thrombosis through its interactions with Protein C, activated Protein C (APC), and Coagulation Factors VII, and VIIa. It enhances the activation of Protein C in response to complexes of Thrombin-Thrombomodulin. In humans, a soluble form of EPCR can be produced by alternative splicing or ADAM17/TACE mediated shedding, and this protein inhibits the anti-coagulant activity of APC. EPCR can be degraded on the surface of endothelial cells by Neutrophil Elastase. Activation of EPCR also protects vascular endothelial cells from Thrombin-induced apoptosis. EPCR binds to CD11b/CD18 (Mac-1) on monocytes and mediates monocyte adhesion to the vascular endothelium. In addition, EPCR binds to the antigen receptor on gamma δ T cells, promotes hematopoietic stem cell retention in the bone marrow, and binds to surface proteins of some species of Plasmodium, contributing to pathogenicity in severe malaria.

Picture

SDS-PAGE

2μg (R: reducing condition, N: non-reducing condition).

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)