Skip to product information
1 of 3

CD30/TNFRSF8 His Tag Protein, Human

CD30/TNFRSF8 His Tag Protein, Human

Catalog Number: UA010362 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $541.00 SGD
Regular price Sale price $541.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms TNFRSF8, CD30, D1S166E, Ki-1
Accession P28908
Amino Acid Sequence

Phe19-Lys379, with C-terminal 8* His FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

72-89kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Feghali-Bostwick C A. et al. (2008) Autoantibodies in patients with chronic obstructive pulmonary disease. American Journal of Respiratory and Critical Care Medicine. 177(2): 156-163.

2、Wang G N. et al. (2017) Prognostic significance of CD30 expression in nasal natural killer/T-cell lymphoma. Oncology Letters. 13(3): 1211-1215.

3、Horie R. et al. (1998) A novel domain in the CD30 cytoplasmic tail mediates NFκB activation. International Immunology. 10(2): 203-210.

4、Xu M L. et al. (2020) Practical approaches on CD30 detection and reporting in lymphoma diagnosis. Am J Surg Pathol. 44(2): 1-14.

Background

CD30, a member of the tumor necrosis factor receptor superfamily, also known as Ki-1, is a kind of type I transmembrane glycoprotein. The CD30 protein is composed of 595 amino acids, and the cytosolic and transmembrane region in the protein are composed of 188 amino acids and 24 amino acids, respectively. The extracellular region is the leading peptide of 18 amino acids, followed by 365 amino acids. CD30 is widely expressed in viral-infected lymphocytes and lymphoma cells and activated T cells. Moreover, CD30 is also expressed in alveolar macrophages, epidermal cells, activated NK cells, decidual cells, resting B cells, granulocytes, thymocytes, and medulla cells. The bind of CD30 and CD30L induces the production of cytokine, which promotes cell proliferation, differentiation, cell growth, stagnation, and death. Binding of CD30 with its receptor ligand activates TNF receptor-associated factor (TRAF)2 and TRAF5, initiating signal transduction pathways that can lead either to proliferation or apoptosis. CD30 induced apoptosis may lead to the self-regression seen in lymphomatoid papulosis lesions, whereas proliferation may result in anaplastic large-cell lymphoma (ALCL). CD30 ligation leads to nuclear factor-kappa B (NFκB) and/or mitogen-activated protein kinase (MAPK) pathways, ultimately leading to survival of neoplastic cells. CD30 can serve both as a diagnostic marker for lymphocyte malignancies and as a target for therapy.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized CD30/TNFRSF8 His Tag, Human (Cat. No. UA010362) at 2μg/mL (100μL/well) can bind Anti-Human CD30 Monoclonal Antibody with EC50 of 4.66-6.44ng/ml. 

Immobilized CD30/TNFRSF8 His Tag Protein, Human (Cat. No. UA010362) at 2μg/mL (100μL/well) can bind CD30 Ligand mFc Chimera Protein, Human (Cat. No. UA010378) with EC50 of 0.29-0.34μg/ml. 

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)