Skip to product information
1 of 1

CCoV N protein , His tag

CCoV N protein , His tag

Catalog Number: S0A9001 Brand: Starter
Price:
Regular price $45 USD
Regular price Sale price $45 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Synonyms 5'-nucleotidase (5'-NT), Acid phosphatase 3, Ecto-5'-nucleotidase, Protein tyrosine phosphatase ACP3, Thiamine monophosphatase (TMPase), ACP3, ACPP
Accession Q7T6S8
Amino Acid Sequence

Protein sequence(Q7T6S8, Met1-Asn382, with C-10*His)
MASQGQRVSWGDESTKRRGRSNSRGRKNNDIPLSFFNPVTLKQGSKFWDLCPRDFVPLKIGNKDQQIGYWNRQIRYRMVKGQRKDLPERWFFYYLGTGPHADAKFKQKLDGVVWVAKEGAMTKPTTLGTRGTNNESKALKFDVKVPSEFQLEVNQSRDNSRSRSQSRSQSRTRAQSRGRQQSNNKKDDSVEQAVLAALKKLGVDTEKQQQRARSKSKERSNSKTRDTTPKNENKHTWKRTAGKGDVTKFYGARSSSANFGDSDLVANGNSAKHYPQLAECVPSVSSILFGSHWTAKEDGDQIEVTFTHKYHLPKDDPKTGQFLQQINAYARPSEVAKEQRLRKARSKSAERVEQEVVPDALTENYTDVFDDTQVEIIDEVTNGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 45.1kDa Actual: 50kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

The nucleocapsid (N) protein is a protein that packages the positive-sense RNA genome of coronaviruses to form ribonucleoprotein structures enclosed within the viral capsid. The N protein is the most highly expressed of the four major coronavirus structural proteins. In addition to its interactions with RNA, N forms protein-protein interactions with the coronavirus membrane protein (M) during the process of viral assembly. N also has additional functions in manipulating the cell cycle of the host cell.

Picture

SDS-PAGE

2μg (R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)