Skip to product information
1 of 2

Biotinylated Fc γ RIIa/CD32a(H167) Avi&His Tag Protein, Human

Biotinylated Fc γ RIIa/CD32a(H167) Avi&His Tag Protein, Human

Catalog Number: UA010430 Reactivity: Human Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $772.00 SGD
Regular price Sale price $772.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Fc γ RIIa, CD32a, FCGR2A, CD32, FCG2, FCGR2A1, IGFR2
Accession P12318
Amino Acid Sequence

Ala36-Ile218, with C- terminal Avi & 8*His Tag AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIGGGSGLNDIFEAQKIEWHEHHHHHHHH

Expression System HEK293
Molecular Weight 30-35kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Descours B. et al. (2017) CD32a is a marker of a CD4 T-cell HIV reservoir harbouring replication-competent proviruses. Nature. 543: 564-567.

Background

Receptors for the Fc region of IgG (Fc γ R) are members of the Ig superfamily that function in the activation or inhibition of immune responses. Human Fc gamma Rs are classified into three classes: RI (CD64), RII (CD32), and RIII (CD16), which give rise to multiple isoforms (1-3). Fc gamma RI is a high-affinity receptor that binds monomeric IgG, and Fc gamma RII and RIII are low-affinity receptors that bind aggregated or immune complex IgG (IC). The extracellular domain of human Fc gamma RIIA shares approximately 90% amino acid sequence identity with human Fc gamma RIIB and Fc gamma RIIC. Fc gamma RIIA is expressed on many immune cell types: macrophages, neutrophils, eosinophils, platelets, dendritic cells, and Langerhans cells, where inhibitory ITIM receptors may also be co-expressed and co-engaged by specific ligands. Signaling through FcγRIIA leads to the initiation of inflammatory responses (cytolysis, phagocytosis, degranulation, and cytokine production) that can be modulated by signals from inhibitory receptors. The strength of the signal depends on the ratio of activated and inhibitory receptor expression.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized Biotinylated Fc γ RIIa/CD32a(H167) Avi&His Tag, Human (Cat. No. UA010430) at 2 μg/mL on Streptavidin precoated (0.5μg/well) plate, can bind IgG1 Fc, Human (Cat. No. UA050001) with EC50 of 0.38-0.44 μg/ml.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)