TSLP (R127A, R130A) His Tag Protein, Human
TSLP (R127A, R130A) His Tag Protein, Human
Product Details
Product Details
Product Specification
| Species | Human |
| Antigen | TSLP |
| Synonyms | Thymic stromal lymphopoietin |
| Accession | Q969D9 |
| Amino Acid Sequence | Tyr29-Gln159(Arg127Ala, Arg130Ala), with C-terminal 10* His YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 22-2 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Luo J, Zhu Z, Zhai Y, Zeng J, Li L, Wang D, Deng F, Chang B, Zhou J, Sun L. The Role of TSLP in Atopic Dermatitis: From Pathogenetic Molecule to Therapeutical Target. Mediators Inflamm. 2023 Apr 15;2023:7697699. 2. 2.Lu H, Wu X, Peng Y, Sun R, Nie Y, Li J, Wang M, Luo Y, Peng L, Fei Y, Zhou J, Zhang W, Zeng X. TSLP promoting B cell proliferation and polarizing follicular helper T cell as a therapeutic target in IgG4-related disease. J Transl Med. 2022 Sep 8;20(1):414. |
Background
Thymic stromal lymphopoietin (TSLP) acts as a hemopoietic cytokine, proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. The protein promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. It is positively associated with AD deterioration. Mainly secreted by keratinocytes, TSLP interacts with multiple immune cells (including dendritic cells, T cells, and mast cells), following induction of Th2-oriented immune response during the pathogenesis of AD.
Picture
Picture
SDS-PAGE
ELISA
Immobilized TSLP (R127A, R130A) His Tag Protein, Human (Cat. No. UA040105) at 2.0μg/mL (100μL/well) can bind V6 Anti-Human TSLP (Tezepelumab) with EC50 of 1.76-2.78 ng/mL.
Immobilized TSLPR Fc Chimera Protein, Human (Cat. No. UA010907) at 5.0μg/mL (100μL/well) can bind TSLP (R127A, R130A) His Tag Protein, Human (Cat. No. UA040105) with EC50 of 14.71-19.25ng/mL.
Immobilized TSLP (R127A, R130A) His Tag Protein, Human (Cat. No. UA040105) at 2.0μg/mL (100μL/well) can bind TSLPR Fc Chimera Protein, Human (Cat. No. UA010907) with EC50 of 1.39-2.35ng/mL.
