Skip to product information
1 of 1

Spike RBD His Tag Protein, SARS-CoV-2(Trimer)

Spike RBD His Tag Protein, SARS-CoV-2(Trimer)

Catalog Number: UA030067 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $947.00 SGD
Regular price Sale price $947.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Spike, S protein
Accession P0DTC2
Amino Acid Sequence

Arg319-Phe541 RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFGGGSGGGSGGGSRMKQIEDKIEEILSKIYHIENEIARIKKLVGERGGGSHHHHHH

Expression System HEK293
Molecular Weight

35-40kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4.
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Yuejun Shi, Jiale Shi, Limeng Sun, Yubei Tan, Gang Wang, Fenglin Guo, Guangli Hu, Yanan Fu, Zhen F Fu, Shaobo Xiao.Insight into vaccine development for Alpha-coronaviruses based on structural and immunological analyses of spike proteins. J Virol. 2021 Mar 10;95(7):e02284-20.Epub 2021 Jan 7.

Background

Coronaviruses that infect humans belong to the Alpha-coronavirus (including HCoV-229E) and Beta-coronavirus (including SARS-CoV and SARS-CoV-2) genera. In particular, SARS-CoV-2 is currently a major threat to public health worldwide. The spike (S) homotrimers bind to their receptors via the receptor-binding domain (RBD), which is a major target to block viral entry. our results reveal different vaccine strategies for coronaviruses, and S-trimer is better than RBD as a target for vaccine development in Alpha-coronavirus Our findings will provide important implications for future development of coronavirus vaccines. Outbreak of coronaviruses, especially SARS-CoV-2, poses a serious threat to global public health. Development of vaccines to prevent the coronaviruses that can infect humans has always been a top priority. Coronavirus spike (S) protein is considered as a major target for vaccine development. Currently, structural studies have shown that Alpha-coronavirus (HCoV-229E) and Beta-coronavirus (SARS-CoV and SARS-CoV-2) RBDs are in "lying" and "standing" states in the prefusion S-trimer structure. Here, we evaluated the ability of S-trimer and RBD to induce neutralizing antibodies among these coronaviruses. Our results showed that the S-trimer and RBD are both candidates for subunit vaccines in Beta-coronavirus (SARS-CoV and SARS-CoV-2) with a RBD "standing" state. However, for Alpha-coronavirus (HCoV-229E) with a RBD "lying" state, the S-trimer may be more suitable for subunit vaccines than the RBD. Our results will provide novel ideas for the development of vaccines targeting S protein in the future.

Picture

Bioactivity

Immobilized ACE2 Fc Chimera, Human (Cat.No.UA020026) at 2.0μg/mL (100μL/well) can bind Spike RBD His Tag, SARS-CoV-2(B.1.1.529/Omicron, N terminal) (Cat.No.UA030036) with EC50 of 1.59-1.88μg/mL , and bind Spike RBD His Tag, SARS-CoV-2(Trimer) (Cat.No.UA030067) with EC50 of 0.53-0.83μg/mL.

SDS-PAGE

1μg (R: reducing condition.

SEC-HPLC

The purity of Spike RBD His Tag, SARS-CoV-2(Trimer) is more than 90% and the molecular weight of this protein is around 100 kDa verified by interpolation estimation of retention time by SEC-HPLC.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)