Product Details
Product Details
Product Specification
Species | Human |
Synonyms | PILRα, PILRA, FDF03, AV021745 |
Accession | Q9UKJ1-1 |
Amino Acid Sequence | Gln20-Thr196, with C-terminal 8*His QPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETGGGSHHHHHHHH |
Expression System | HEK293 |
Molecular Weight | 41-47kDa |
Purity | >95% by SDS-PAGE |
Endotoxin | <0.1EU/μg |
Conjugation | Unconjugated |
Tag | His Tag |
Physical Appearance | Lyophilized Powder |
Storage Buffer | PBS, pH7.4 |
Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Reference |
1、Shiratori I. et al. (2004) Activation of natural killer cells and dendritic cells upon recognition of a novel CD99-like ligand by paired immunoglobulin-like type 2 receptor. J Exp Med. 199: 525-533. 2、Satoh T. et al. (2008) PILRα is a herpes simplex virus-1 entry coreceptor that associates with glycoprotein B. Cell. 132: 935-944. 3、Wang J. et al. (2013) Neutrophilin filtration during inflammation is regulated by PILRαvia modulation ofintegrin activation. Nat Immunol. 14: 34-40. 4、Sun Y. et al. (2014) PILRα negatively regulates mouse inflammatoryarthritis. J Immunol. 193: 860-870. |
Background
Paired immunoglobulin-like type 2 receptor α (PILRα) is an inhibitory receptor that is mainly expressed on macrophages, dendritic cells and granulocytes, and negatively regulates neutrophil infiltration during inflammation. PILRα containing two immunoreceptor tyrosine-based inhibitory motifs in the intracellular domain, which recruit Src homology region 2 domain-containing phosphatase (SHP)-1 and -2. Reported that PILRα associates with several ligands, including CD99, PILR-associating neural protein, neuronal differentiation proliferation factor-1, and collectin-12, and PILRα plays an important role in viral infections. Neutrophil recruitment in inflammatory responses is regulated by PILRα via modulation of integrin activation. Furthermore, negative regulation of inflammatory arthritis by PILRα has been reported.
Picture
Picture
SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).
