Skip to product information
1 of 1

Mouse NK1.1, His tag

Mouse NK1.1, His tag

Catalog Number: S0A1076 Brand: Starter
Price:
Regular price $176.00 SGD
Regular price Sale price $176.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Killer cell lectin-like receptor subfamily B member 1G, Natural killer cell surface protein NKR-P1G, Natural killer lectin-like receptor 1E, Gm4696, Klrb1d, Klrb1g, Klrb6, Nkrp1g
Accession Q0ZUP1
Amino Acid Sequence

Protein sequence (Q0ZUP1, Gln64-Val214, with C-10*His) QKPLIEKCSVAVQENRTEPTGRSATLECPRDWHPHCDKCLFTSQTSRPWADGLVDCNLKGATLLLIQDEEELRLLQNFSKGKGQQFYIGLKYEEVDKVWKWMNGSILNTNLLQITGKDEENSCALISQTEVFSDSCSSDNHWICQKTLKHVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 18.9 kDa Observed MW: 20-30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Killer cell lectin-like receptor subfamily B, member 1, also known as KLRB1, NKR-P1A or CD161 (cluster of differentiation 161), is a human gene. Natural killer (NK) cells are lymphocytes that mediate cytotoxicity and secrete cytokines after immune stimulation. Several genes of the C-type lectin superfamily, including the rodent NKRP1 family of glycoproteins, are expressed by NK cells and may be involved in the regulation of NK cell function. The KLRB1 protein contains an extracellular domain with several motifs characteristic of C-type lectins, a transmembrane domain, and a cytoplasmic domain. The KLRB1 protein, NKR-P1A or CD161, is classified as a type II membrane protein because it has an external C terminus. NKR-P1A, the receptor encoded by the KLRB1 gene, recognizes Lectin Like Transcript-1 (LLT1) as a functional ligand.

Picture

SDS-PAGE

2μg(R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)