Skip to product information
1 of 1

Mouse CD8A Protein, His tag

Mouse CD8A Protein, His tag

Catalog Number: S0A1127 Reactivity: Mouse Conjugation: Unconjugated Brand: Starter
Price:
Regular price $435.00 SGD
Regular price Sale price $435.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms T-cell surface glycoprotein CD8 alpha chain, T-cell surface glycoprotein Lyt-2, Lyt-2, Lyt2
Accession P01731
Amino Acid Sequence

Protein sequence (P01731, Lys28-Tyr196, with C-His tag) KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY

Expression System HEK293
Molecular Weight Predicted MW: 20.6 kDa Observed MW: 33 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen-presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. The extracellular IgV-like domain of CD8-α interacts with the α3 portion of the Class I MHC molecule. This affinity keeps the T cell receptor of the cytotoxic T cell and the target cell bound closely together during antigen-specific activation. Cytotoxic T cells with CD8 surface protein are called CD8+ T cells.

Picture

Bioactivity

Immobilized Mouse CD8A Protein, His tag at 4 μg/mL (50 μL/well) can bind CD8α Recombinant Rabbit mAb (SDT-142-52) (Cat. No. S0B0034) with EC50 of 7.105-8.377 ng/ml.

SDS-PAGE

2 μg(R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)