Skip to product information
1 of 1

Human PRL, His tag

Human PRL, His tag

Catalog Number: S0A0016 Brand: Starter
Price:
Regular price $500.00 SGD
Regular price Sale price $500.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Prolactin, Lactotropin
Accession P01236
Amino Acid Sequence

Protein sequence(P01236, Leu29-Cys227, with C-10*His)
LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 24.5kDa Actual:25,28kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Prolactin (PRL), also known as lactotropin, is a protein best known for its role in enabling mammals to produce milk. Prolactin is secreted from the pituitary gland in response to eating, mating, estrogen treatment, ovulation and nursing. It is secreted heavily in pulses in between these events. Prolactin plays an essential role in metabolism, regulation of the immune system and pancreatic development. Prolactin levels may be checked as part of a sex hormone workup, as elevated prolactin secretion can suppress the secretion of follicle stimulating hormone and gonadotropin-releasing hormone, leading to hypogonadism and sometimes causing erectile dysfunction. Prolactin levels may be of some use in distinguishing epileptic seizures from psychogenic non-epileptic seizures. The serum prolactin level usually rises following an epileptic seizure.

Picture

SDS-PAGE

2μg (R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)