Skip to product information
1 of 1

Human PINP, His tag

Human PINP, His tag

Catalog Number: S0A7001 Brand: Starter
Price:
Regular price $715.00 SGD
Regular price Sale price $715.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Procollagen I N-Terminal Propeptide
Accession P02452
Amino Acid Sequence

Protein sequence(P02452, Gln23-Pro161, with C-10*His)
QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 15.9kDa Actual:23kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Type 1 collagen is the major collagen in the body and is mainly found in mineralised bone. It has a triple helical structure consisting of one α1 and two α2 chains which are linked by disulphide bonds. The molecule is synthesised as procollagen which is proteolytically cleaved to remove both the N‐ and C- terminal parts of the molecule prior to the assembly of the remainder into the collagen matrix. The N‐ and C‐terminals are released into the circulation stoichiometrically and thus reflect the synthesis of new type 1 collagen.The amino-terminal propeptide of type I procollagen (PINP) is probably the most specific and sensitive marker of bone formation. PINP is a useful marker for monitoring the efficacy of osteoporosis therapy with anabolic agents, but it is also one of the best bone turnover markers for monitoring the efficacy of anti-resorptive therapy.

Picture

SDS-PAGE

2μg (R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)