Skip to product information
1 of 1

Human h-FABP3, His Tag

Human h-FABP3, His Tag

Catalog Number: S0A0011 Brand: Starter
Price:
Regular price $487.00 SGD
Regular price Sale price $487.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Fatty acid-binding protein 3, Heart-type fatty acid-binding protein (H-FABP), Mammary-derived growth inhibitor (MDGI), Muscle fatty acid-binding protein (M-FABP)
Accession P05413
Amino Acid Sequence

Protein sequence(P05413, Met1-Ala133 with C-10*His)


MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEAGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 16.5kDa Actual: 18kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Heart-type fatty acid binding protein (hFABP) also known as mammary-derived growth inhibitor is a protein that in humans is encoded by the FABP3 gene. Heart-type Fatty Acid-Binding Protein (H-FABP) is a small cytoplasmic protein (15 kDa) released from cardiac myocytes following an ischemic episode. H-FABP is a sensitive biomarker for myocardial infarction and can be detected in the blood within one to three hours of the pain. In addition to its diagnostic potential, H-FABP also has prognostic value. Alongside D-dimer, NT-proBNP and peak troponin T, it was the only cardiac biomarker that proved to be a statistically significant predictor of death or MI at one year. This prognostic information was independent of troponin T, ECG and clinical examination.

Picture

SDS-PAGE

2μg (R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)