Skip to product information
1 of 1

Human GP73, His tag

Human GP73, His tag

Catalog Number: S0A6010 Brand: Starter
Price:
Regular price $630.00 SGD
Regular price Sale price $630.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Golgi membrane protein GP73, Golgi phosphoprotein 2, GOLM2
Accession Q8NBJ4
Amino Acid Sequence

Protein sequence(Q8NBJ4, Arg55-Leu401, with C-10*His)
RAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 41kDa Actual: 65kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Golgi protein-73 (GP73) is a type II Golgi-localized integral membrane protein that is normally expressed in epithelial cells of many human tissues. It is essential for human survival, and might have multiple roles for GP73 in epithelial cell function such as in the kidney and liver. GP73 has been suggested as a potential serum marker for the diagnosis of hepatocellular carcinoma (HCC),Several reports have stated that GP73 is a better marker than AFP for diagnos ing HCC. Many studies have demonstrated that significant increases of  non-viral causes (alcohol-induced liver dis ease, autoimmune hepatitis). Therefore, some researchers consider that an increase in GP73 expression is a common feature of hepatocyte response to a variety of disease etiologies.

Picture

SDS-PAGE

2μg (R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)