Skip to product information
1 of 2

Human CD81, His Tag

Human CD81, His Tag

Catalog Number: S0A1007 Brand: Starter
Price:
Regular price $345.00 SGD
Regular price Sale price $345.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28 (Tspan-28)
Accession P60033
Amino Acid Sequence

Protein sequence(P60033, Phe113-Lys201, with C-10*His)


FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 11.4kDa Actual:11kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70℃ as supplied.

1 month, 2 to 8℃ under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

CD81 is a member of the transmembrane 4 superfamily and it is a cell surface glycoprotein that is known to complex with integrins. CD81 appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. Moreover, CD81 plays a critical role in Hepatitis C attachment and cell entry by interacting with virus' E1/E2 glycoproteins heterodimer. The large extracellular loop of CD81 binds the hepatitis E2 glycoprotein dimer. It also appears to play a role in liver invasion by Plasmodium species.

Picture

Bioactivity

Immobilized Human CD81, His Tag at 4 μg/mL (50 μL/well) can bind CD81 Recombinant Rabbit mAb (SDT-144-22) (S0B0053) with EC50 of 4.568-6.102 ng/ml.

SDS-PAGE

2μg (R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)