1μg (R: reducing conditions, N: non-reducing conditions).
EphA7 His Tag Protein, Human
EphA7 His Tag Protein, Human
Price:
Regular price
$726.00 SGD
Regular price
Sale price
$726.00 SGD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Antigen | EphA7 |
| Synonyms | EHK-3 Protein, EHK3 Protein, EK11 Protein, EPHA7 Protein, HEK11 Protein |
| Accession | Q15375-1 |
| Amino Acid Sequence | Gln28-Val555, with C-terminal 10*His QAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 68-75kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1． Xiangyi Chen, Dechen Yu, Haiyu Zhou, Xiaobo Zhang, Yicun Hu, Ruihao Zhang, Xidan Gao, Maoqiang lin, Taowen Guo & Kun Zhang Clinical and Translational Oncology volume 24, pages1274-1289 (2022). |
Background
Ephrin-a receptor 7, also known as EphA7, belongs to the Ephrin receptor subfamily of the protein tyrosine kinase family. The Eph family is the largest group of related receptor tyrosine kinases known, consisting of 16 members in the vertebrate genome. EPHA7 functions as a repulsive guidance molecule during the targeting of retinal axons to the superior colliculus and of neocortical axons to the thalamus. At the same time, in recent years, more and more studies have shown that EphA7 protein is abnormally expressed in a variety of malignant tumors, involved in tumor occurrence and metastasis, and correlated with patient prognosis.
Picture
Picture
SDS-PAGE
