Skip to product information
1 of 1

EphA7 His Tag Protein, Human

EphA7 His Tag Protein, Human

Catalog Number: UA010592 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $560 USD
Regular price Sale price $560 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen EphA7
Synonyms EHK-3 Protein, EHK3 Protein, EK11 Protein, EPHA7 Protein, HEK11 Protein
Accession Q15375-1
Amino Acid Sequence

Gln28-Val555, with C-terminal 10*His QAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 68-75kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Xiangyi Chen, Dechen Yu, Haiyu Zhou, Xiaobo Zhang, Yicun Hu, Ruihao Zhang, Xidan Gao, Maoqiang lin, Taowen Guo & Kun Zhang Clinical and Translational Oncology volume 24, pages1274-1289 (2022).

Background

Ephrin-a receptor 7, also known as EphA7, belongs to the Ephrin receptor subfamily of the protein tyrosine kinase family. The Eph family is the largest group of related receptor tyrosine kinases known, consisting of 16 members in the vertebrate genome. EPHA7 functions as a repulsive guidance molecule during the targeting of retinal axons to the superior colliculus and of neocortical axons to the thalamus. At the same time, in recent years, more and more studies have shown that EphA7 protein is abnormally expressed in a variety of malignant tumors, involved in tumor occurrence and metastasis, and correlated with patient prognosis.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).