Skip to product information
1 of 2

CEACAM-6/CD66c His Tag Protein, Human

CEACAM-6/CD66c His Tag Protein, Human

Catalog Number: UA010336 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $520 USD
Regular price Sale price $520 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CEACAM6, CD66c, CEAL, NCA
Accession P40199-1
Amino Acid Sequence

Lys35-Gly320, with C-terminal 8*His KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

45-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Duxbury M S. et al. (2004) Overexpression of CEACAM6 promotes insulin-like growth factor I-induced pancreatic adenocarcinoma cellular invasiveness. Oncogene. 23(34): 5834-5842.

2、Lewis-Wambi J S. et al. (2008) Overexpression of CEACAM6 promotes migration and invasion of oestrogen-deprived breast cancer cells. Eur J Cancer. 44(12): 1770-1779.

Background

Carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) (CEACAM6) is also known as CD66c (Cluster of Differentiation 66c), CEAL, NCA, and is one of seven human CEACAM family members within the immunoglobulin superfamily. Human CEACAM-6 is a 90 kDa, GPI-linked membrane protein that contains a 34 amino acid (aa) signal sequence, a 286 aa extracellular domain (ECD), and a 24 aa hydrophobic C-terminal propeptide. CEACAM-6 contains one N-terminal V-type Ig-like domain (N domain), followed by two C2-type Ig-like domains. It shows considerable glycosylation, including (sialyl) LewisX, which mediates binding to E-selectin, galectins and some bacterial fimbrae. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis.

Picture

SDS-PAGE

2μg (R: reducing condition, N: non-reducing condition).

ELISA

Immobilized CEACAM-6/CD66c His Tag Protein, Human (Cat. No. UA010336) at 10μg/mL (100μL/well) can bind Biotinylated Human CD66b, His tag with EC50 of 16.56-27.32ng/mL.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)