Skip to product information
1 of 1

Biotinylated Fc γ RIIB/CD32b Avi&His Tag Protein, Mouse

Biotinylated Fc γ RIIB/CD32b Avi&His Tag Protein, Mouse

Catalog Number: UA010538 Reactivity: Mouse Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $724.00 SGD
Regular price Sale price $724.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Antigen Fc γ RIIB/CD32b
Synonyms Fc γ RII B
Accession P08101-1
Amino Acid Sequence

Thr40-Arg217, with C-terminal Avi&8*His Tag THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRGGGSGLNDIFEAQKIEWHEHHHHHHHH

Expression System HEK293
Molecular Weight 35-43kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Emily L. Williams; Alison L. Tutt; Stephen A. Beers; Ruth R. French; Claude H. T. Chan; Kerry L. Cox; Ali Roghanian; Christine A. Penfold; Cherié L. Butts; Peter Boross; J. Sjef Verbeek; Mark S. Cragg; Martin J. Glennie: Immunotherapy Targeting Inhibitory Fcγ Receptor IIB (CD32b) in the Mouse Is Limited by Monoclonal Antibody Consumption and Receptor Internalization, J Immunol (2013) 191 (8): 4130-4140.

Background

IgG Fc region receptors are members of the Ig superfamily that play roles in activating or inhibiting immune responses such as degranulation, phagocytosis, ADCC, cytokine release, and B-cell proliferation. There are three genes for human Fc γ RII /CD32 (A, B, and C) and one for mouse Fc γ RII B (CD32B). Three distinct genes encode the human CD32 group. These proteins share 94-99% amino acid identity in their extracellular domains but have divergent cytoplasmic domains and signaling capacities. CD32 is a low affinity receptor for IgG. CD32B is expressed on B cells and myeloid dendritic cells. a single gene encodes mouse CD32. The protein product delivers an inhibitory signal upon ligand binding and is functionally equivalent to human Fc gamma RIIB. Mouse CD32 is the only Fc gamma R expressed on B cells and is also expressed on macrophages, neutrophils and mast cells. Mouse CD16 is closely related to mouse CD32 throughout its extracellular domain (95% amino acid identity), but has a divergent cytoplasmic domain and functions as an activating receptor. Together these proteins constitute an activating/inhibiting receptor pair to regulate immune responses.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)