Skip to product information
1 of 6

BCMA/TNFRSF17 His Tag Protein, Human

BCMA/TNFRSF17 His Tag Protein, Human

Catalog Number: UA010083 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $727.00 SGD
Regular price Sale price $727.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen BCMA/TNFRSF17
Accession Q02223-1
Amino Acid Sequence

Met1-Ala54, with C-terminal 8*His MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

15-19kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.

Picture

FC

2e5 of transient transfected anti-BCMA ScFv CAR-293 cells were stained with 0.1ug BCMA His Tag Protein, Human, (Cat. No. UA010083) and unlable respectively (Fig. C and B), and non-transfected 293 cells were used as a control (Fig. A). Alexa Fluor 647 signal was used to evaluate the binding activity. 2e5 of transient transfected anti- BCMA ScFv CAR-293 cells were stained with competitor respectively (Fig.D). APC signal was used to evaluate the binding activity. 2e5 of transient transfected anti- BCMA ScFv CAR-293 cells were stained with isotype and Whitlow/218 Linker-Alexa Fluor® 488 (Fig. E and F). Alexa Fluor® 488 signal was used to evaluate the binding activity.

SDS-PAGE

1μg(R: reducing conditions, N: non-reducing conditions).

SEC-HPLC

The purity of BCMA/TNFRSF17 His Tag Protein, Human is greater than 95% as determined by SEC-HPLC.

ELISA

Immobilized BCMA/TNFRSF17 His Tag Protein, Human (Cat. No. UA010083) at 2.0μg/mL (100μL/well) can bind Anti-Human BCMA (Belantamab) with EC50 of 0.68-0.88ng/mL.

Immobilized BCMA/TNFRSF17 His Tag Protein, Human (Cat. No. UA010083) at 2.0μg/mL (100μL/well) can bind Anti-Human BCMA (Belantamab), LotA with EC50 of 1.00-1.55ng/mL. LotB with EC50 of 1.15-1.66ng/mL.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)