Skip to product information
1 of 3

B7-1/CD80 His Tag Protein, Human

B7-1/CD80 His Tag Protein, Human

Catalog Number: UA010085 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $468 USD
Regular price Sale price $468 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P33681-1
Amino Acid Sequence Val35-Asn242, with C-terminal 10*His VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 43-55kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

As the first identified B7 family member, CD80 is widely expressed in a broad spectrum of tissues, even on some malignant tumor cells, thereby suggesting the potential mechanism of immune evasion of tumor cells.CD80 is recognized as one of the most potent costimulatory molecules by which immune cells limit malignant growth. It is upregulated upon cell stress and it is critical for efficacious immune surveillance during carcinogenesis. Low surface expression of CD80 was reported as an immune escape mechanism of colon carcinoma; on the other hand, its expression resulted enhanced in high-frequency microsatellite instability (MSI) colorectal cancers, a CRC subtype which is highly immunogenic and associated with a better prognosis. Both in vivo and in vitro studies showed that the upregulation of CD80 on tumor cell surface successfully activates antitumor immune responses, while its expression is frequently lost during tumor progression probably due to selective pressure by the immune system. Thus, to develop effective approaches for cancer immunotherapy, strategies for enhancing CD80 expression in tumors are urgently required.

Picture

Bioactivity

Anti-His antibody Immobilized on CM5 Chip captured B7-1/CD80 His Tag, Human (Cat. No. UA010085), can bind CTLA-4 Fc Chimera, Human (Cat. No. UA010039) with an affinity constant of 8.432nM as determined in SPR assay (Biacore T200).
Immobilized B7-1/CD80 His Tag, Human (Cat. No. UA010085) at 5μg/mL (100μL/well) can bind CTLA-4 Fc Chimera, Human (Cat. No. UA010039) with EC50 of 85.96ng/mL.

SDS-PAGE

1μg(R: reducing conditions, N: non-reducing conditions).